Lineage for d4g4ee_ (4g4e E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1222782Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1222798Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)
  8. 1222804Domain d4g4ee_: 4g4e E: [197308]
    automated match to d1e94a_
    mutant

Details for d4g4ee_

PDB Entry: 4g4e (more details), 2.89 Å

PDB Description: crystal structure of the l88a mutant of hslv from escherichia coli
PDB Compounds: (E:) ATP-dependent protease subunit HslV

SCOPe Domain Sequences for d4g4ee_:

Sequence, based on SEQRES records: (download)

>d4g4ee_ d.153.1.4 (E:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmarkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

Sequence, based on observed residues (ATOM records): (download)

>d4g4ee_ d.153.1.4 (E:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrrkleallavadetasliitgngdvvqpendliaigsg
gpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOPe Domain Coordinates for d4g4ee_:

Click to download the PDB-style file with coordinates for d4g4ee_.
(The format of our PDB-style files is described here.)

Timeline for d4g4ee_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4g4ec_