Lineage for d4fjva_ (4fjv A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399597Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins)
    probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model
  6. 1399601Protein automated matches [197305] (1 species)
    not a true protein
  7. 1399602Species Human (Homo sapiens) [TaxId:9606] [197306] (1 PDB entry)
  8. 1399603Domain d4fjva_: 4fjv A: [197307]
    Other proteins in same PDB: d4fjvb_, d4fjvd_
    automated match to d1tffa_
    complexed with gol, neh

Details for d4fjva_

PDB Entry: 4fjv (more details), 2.05 Å

PDB Description: Crystal Structure of Human Otubain2 and Ubiquitin Complex
PDB Compounds: (A:) Ubiquitin thioesterase OTUB2

SCOPe Domain Sequences for d4fjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fjva_ d.3.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralgysyl
esllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkv
fndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqit
alsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaad

SCOPe Domain Coordinates for d4fjva_:

Click to download the PDB-style file with coordinates for d4fjva_.
(The format of our PDB-style files is described here.)

Timeline for d4fjva_: