SCOPe 2.03: Domain d4fjva_: 4fjv A:

Lineage for d4fjva_ (4fjv A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins)
   probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model

6. Protein automated matches [197305] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [197306] (1 PDB entry)

8. Domain d4fjva_: 4fjv A: [197307]
   Other proteins in same PDB: d4fjvb_, d4fjvd_
   automated match to d1tffa_
   complexed with gol, neh

Details for d4fjva_

PDB Entry: 4fjv, 2.05 Å

PDB Description: Crystal Structure of Human Otubain2 and Ubiquitin Complex

PDB Compounds: (A:) Ubiquitin thioesterase OTUB2

SCOPe Domain Sequences for d4fjva_:

Sequence; same for both SEQRES and ATOM records:

>d4fjva_ d.3.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralgysyl
esllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkv
fndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqit
alsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaad

Timeline for d4fjva_:

• d4fjva_ first appeared in SCOPe 2.02
  
• d4fjva_ appears in SCOPe 2.04
  
• d4fjva_ appears in the current release, SCOPe 2.08, called d4fjva1