| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins) probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model |
| Protein automated matches [197305] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [197306] (1 PDB entry) |
| Domain d4fjva_: 4fjv A: [197307] Other proteins in same PDB: d4fjvb_, d4fjvd_ automated match to d1tffa_ complexed with gol, neh |
PDB Entry: 4fjv (more details), 2.05 Å
SCOPe Domain Sequences for d4fjva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fjva_ d.3.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralgysyl
esllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkv
fndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqit
alsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaad
Timeline for d4fjva_: