Lineage for d4fjvb_ (4fjv B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402319Protein Ubiquitin [54238] (7 species)
  7. 1402386Species Human (Homo sapiens) [TaxId:9606] [54239] (99 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 1402447Domain d4fjvb_: 4fjv B: [197304]
    Other proteins in same PDB: d4fjva_, d4fjvc_
    automated match to d3nobh_
    complexed with gol, neh

Details for d4fjvb_

PDB Entry: 4fjv (more details), 2.05 Å

PDB Description: Crystal Structure of Human Otubain2 and Ubiquitin Complex
PDB Compounds: (B:) Polyubiquitin-C

SCOPe Domain Sequences for d4fjvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fjvb_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
dvpdyahmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
rtlsdyniqkestlhlvlrlrg

SCOPe Domain Coordinates for d4fjvb_:

Click to download the PDB-style file with coordinates for d4fjvb_.
(The format of our PDB-style files is described here.)

Timeline for d4fjvb_: