![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189560] (37 PDB entries) |
![]() | Domain d4fjvb_: 4fjv B: [197304] Other proteins in same PDB: d4fjva_ automated match to d3nobh_ complexed with gol, neh |
PDB Entry: 4fjv (more details), 2.05 Å
SCOPe Domain Sequences for d4fjvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fjvb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dvpdyahmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledg rtlsdyniqkestlhlvlrlrg
Timeline for d4fjvb_: