SCOPe 2.02: Domain d4fjvb_: 4fjv B:

Lineage for d4fjvb_ (4fjv B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (37 PDB entries)

8. Domain d4fjvb_: 4fjv B: [197304]
   Other proteins in same PDB: d4fjva_
   automated match to d3nobh_
   complexed with gol, neh

Details for d4fjvb_

PDB Entry: 4fjv, 2.05 Å

PDB Description: Crystal Structure of Human Otubain2 and Ubiquitin Complex

PDB Compounds: (B:) Polyubiquitin-C

SCOPe Domain Sequences for d4fjvb_:

Sequence; same for both SEQRES and ATOM records:

>d4fjvb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvpdyahmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
rtlsdyniqkestlhlvlrlrg

Timeline for d4fjvb_:

• d4fjvb_ is new in SCOPe 2.02-stable
  
• d4fjvb_ appears in SCOPe 2.03
  
• d4fjvb_ appears in the current release, SCOPe 2.08, called d4fjvb1