![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
![]() | Protein automated matches [190903] (22 species) not a true protein |
![]() | Species Methylibium petroleiphilum [TaxId:420662] [197231] (2 PDB entries) |
![]() | Domain d4fdxa_: 4fdx A: [197298] automated match to d4otba_ |
PDB Entry: 4fdx (more details), 1.64 Å
SCOPe Domain Sequences for d4fdxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fdxa_ d.80.1.0 (A:) automated matches {Methylibium petroleiphilum [TaxId: 420662]} piiqmnllegrtveqkrnavaaiteavvrtldvrpdqvrilinelgvehfsvagqtaamr q
Timeline for d4fdxa_: