Lineage for d4br1b_ (4br1 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1815295Protein Triosephosphate isomerase [51353] (20 species)
  7. 1815359Species Human (Homo sapiens) [TaxId:9606] [51355] (5 PDB entries)
  8. 1815363Domain d4br1b_: 4br1 B: [197296]
    automated match to d2jk2b_

Details for d4br1b_

PDB Entry: 4br1 (more details), 1.9 Å

PDB Description: Protease-induced heterodimer of human triosephosphate isomerase.
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d4br1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4br1b_ c.1.1.1 (B:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinakq

SCOPe Domain Coordinates for d4br1b_:

Click to download the PDB-style file with coordinates for d4br1b_.
(The format of our PDB-style files is described here.)

Timeline for d4br1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4br1a_