Lineage for d4br1a_ (4br1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078563Protein Triosephosphate isomerase [51353] (20 species)
  7. 2078627Species Human (Homo sapiens) [TaxId:9606] [51355] (7 PDB entries)
  8. 2078632Domain d4br1a_: 4br1 A: [197295]
    automated match to d2jk2b_

Details for d4br1a_

PDB Entry: 4br1 (more details), 1.9 Å

PDB Description: Protease-induced heterodimer of human triosephosphate isomerase.
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4br1a_:

Sequence, based on SEQRES records: (download)

>d4br1a_ c.1.1.1 (A:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
rkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
iacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaqe
vheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvdi
inakq

Sequence, based on observed residues (ATOM records): (download)

>d4br1a_ c.1.1.1 (A:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
rkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiavaa
qncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalaeglgv
iacigekkvvfeqtkviadnvkdwskvvlayepvwatpqqaqevheklrgwlksnvsdav
aqstriiyggsvtgatckelasqpdvdgflvggaslkpefvdiinakq

SCOPe Domain Coordinates for d4br1a_:

Click to download the PDB-style file with coordinates for d4br1a_.
(The format of our PDB-style files is described here.)

Timeline for d4br1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4br1b_