Lineage for d3zkna_ (3zkn A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1131756Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 1131757Protein automated matches [190954] (7 species)
    not a true protein
  7. 1131778Species Homo sapiens [TaxId:9606] [193159] (6 PDB entries)
  8. 1131783Domain d3zkna_: 3zkn A: [197283]
    automated match to d2qzka_
    complexed with dms, gol, so4, wzv

Details for d3zkna_

PDB Entry: 3zkn (more details), 2 Å

PDB Description: bace2 fab inhibitor complex
PDB Compounds: (A:) Beta-secretase 2

SCOPe Domain Sequences for d3zkna_:

Sequence, based on SEQRES records: (download)

>d3zkna_ b.50.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
nflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdters
styrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwng
ilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggie
pslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkv
fdavveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfriti
lpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcae
iagaavseisgpfstedvasncvp

Sequence, based on observed residues (ATOM records): (download)

>d3zkna_ b.50.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
nflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdters
styrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwng
ilglayatlakpsssletffdslvtqanipnvfsmqmcganggslvlggiepslykgdiw
ytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveava
raslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpm
mgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavsei
sgpfstedvasncvp

SCOPe Domain Coordinates for d3zkna_:

Click to download the PDB-style file with coordinates for d3zkna_.
(The format of our PDB-style files is described here.)

Timeline for d3zkna_: