Lineage for d3vtja_ (3vtj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005869Species Sphingomonas paucimobilis [TaxId:13689] [190001] (7 PDB entries)
  8. 2005876Domain d3vtja_: 3vtj A: [197280]
    automated match to d3awma_
    complexed with hem; mutant

Details for d3vtja_

PDB Entry: 3vtj (more details), 2.56 Å

PDB Description: cytochrome p450sp alpha (cyp152b1) mutant a245h
PDB Compounds: (A:) Fatty acid alpha-hydroxylase

SCOPe Domain Sequences for d3vtja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vtja_ a.104.1.0 (A:) automated matches {Sphingomonas paucimobilis [TaxId: 13689]}
gpdetlslladpyrfisrqcqrlganafesrfllkktnclkgakaaeifydttrferega
mpvaiqktllgqggvqgldgethrhrkqmfmglmtpervralaqlfeaewrravpgwtrk
geivfydelhepltravcawagvplpddeagnragelralfdaagsasprhlwsrlarrr
vdawakriiegiragsigsgsgtaayaiawhrdrhddllsphvaavelvnvlrptvhiav
yitfvahalqtcsgiraalvqqpdyaelfvqevrrfypffpavvarasqdfewegmafpe
grqvvldlygsnhdaatwadpqefrperfrawdedsfnfipqgggdhylghrcpgewivl
aimkvaahllvnamrydvpdqdlsidfarlpalpksgfvmrnvhigg

SCOPe Domain Coordinates for d3vtja_:

Click to download the PDB-style file with coordinates for d3vtja_.
(The format of our PDB-style files is described here.)

Timeline for d3vtja_: