Lineage for d1wioa1 (1wio A:1-97)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352553Protein CD4 V-set domains [48737] (2 species)
  7. 2352554Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries)
  8. 2352586Domain d1wioa1: 1wio A:1-97 [19728]
    Other proteins in same PDB: d1wioa3, d1wioa4, d1wiob3, d1wiob4
    domains 1 and 3

Details for d1wioa1

PDB Entry: 1wio (more details), 3.9 Å

PDB Description: structure of t-cell surface glycoprotein cd4, tetragonal crystal form
PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1wioa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wioa1 b.1.1.1 (A:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d1wioa1:

Click to download the PDB-style file with coordinates for d1wioa1.
(The format of our PDB-style files is described here.)

Timeline for d1wioa1: