![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
![]() | Protein CD4 V-set domains [48737] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries) |
![]() | Domain d1wioa1: 1wio A:1-97 [19728] Other proteins in same PDB: d1wioa3, d1wioa4, d1wiob3, d1wiob4 |
PDB Entry: 1wio (more details), 3.9 Å
SCOP Domain Sequences for d1wioa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wioa1 b.1.1.1 (A:1-97) CD4 V-set domains {Human (Homo sapiens)} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1wioa1:
![]() Domains from other chains: (mouse over for more information) d1wiob1, d1wiob2, d1wiob3, d1wiob4 |