Lineage for d4ku4a_ (4ku4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114062Species Cryphonectria parasitica [TaxId:5116] [197276] (1 PDB entry)
  8. 2114063Domain d4ku4a_: 4ku4 A: [197277]
    automated match to d3cf6r_
    complexed with gdp, mg

Details for d4ku4a_

PDB Entry: 4ku4 (more details), 1.6 Å

PDB Description: Crystal Structure of a Ras-like Protein from Cryphonectria parasitica in Complex with GDP
PDB Compounds: (A:) Ras-3 from Cryphonectria parasitica

SCOPe Domain Sequences for d4ku4a_:

Sequence, based on SEQRES records: (download)

>d4ku4a_ c.37.1.0 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
agkitdkiamlgeggvgktsltvnltkhvfsetydptledsyrrqcvidgipshleildt
agqeeygalreqwirqnelfvivfdvtrrssfeaaerlfeeviqtkrkldetrrhpgdrh
pddlpfapslvvlvgnkcdldtrrevgtlegsslakklgcgfvetsaklgtnveeaffsv
vradrrrkr

Sequence, based on observed residues (ATOM records): (download)

>d4ku4a_ c.37.1.0 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
agkitdkiamlgeggvgktsltvnltkhvfsetydptledsyrrqcvidgipshleildt
aggalreqwirqnelfvivfdvtrrssfeaaerlfeeviqtkrkldetpfapslvvlvgn
kcdldtrrevgtlegsslakklgcgfvetsaklgtnveeaffsvvradrrrkr

SCOPe Domain Coordinates for d4ku4a_:

Click to download the PDB-style file with coordinates for d4ku4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ku4a_: