Lineage for d4kuna1 (4kun A:1-90)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879945Species Legionella pneumophila [TaxId:297246] [197273] (1 PDB entry)
  8. 2879946Domain d4kuna1: 4kun A:1-90 [197274]
    Other proteins in same PDB: d4kuna2
    automated match to d2qkea_

Details for d4kuna1

PDB Entry: 4kun (more details), 1.95 Å

PDB Description: Crystal structure of Legionella pneumophila Lpp1115 / KaiB
PDB Compounds: (A:) Hypothetical protein Lpp1115

SCOPe Domain Sequences for d4kuna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kuna1 c.47.1.0 (A:1-90) automated matches {Legionella pneumophila [TaxId: 297246]}
mtrtklklfvignsaiskraiinlqsicsdpkladlcdievvdlcknkgiaeqekilatp
ilikkeplperriigdlsdkqkvisalemd

SCOPe Domain Coordinates for d4kuna1:

Click to download the PDB-style file with coordinates for d4kuna1.
(The format of our PDB-style files is described here.)

Timeline for d4kuna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kuna2
View in 3D
Domains from other chains:
(mouse over for more information)
d4kunb_