Lineage for d4kt7a1 (4kt7 A:1-230)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133953Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2133954Protein automated matches [190951] (26 species)
    not a true protein
  7. 2133958Species Anaerococcus prevotii [TaxId:525919] [189838] (2 PDB entries)
  8. 2133959Domain d4kt7a1: 4kt7 A:1-230 [197272]
    Other proteins in same PDB: d4kt7a2
    automated match to d1w77a1
    complexed with cl, na

Details for d4kt7a1

PDB Entry: 4kt7 (more details), 2 Å

PDB Description: The crystal structure of 4-diphosphocytidyl-2C-methyl-D-erythritolsynthase from Anaerococcus prevotii DSM 20548
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d4kt7a1:

Sequence, based on SEQRES records: (download)

>d4kt7a1 c.68.1.0 (A:1-230) automated matches {Anaerococcus prevotii [TaxId: 525919]}
midgkfisaiitaagsglrmrskinkpyievggrkvleitldtvsrvkeideiilvirkd
dediikdilekydgniryvygsttrelstfeglkaldpqselvlthdgvrpfaseelflk
tinalrknkavitatkskdtvkiidddmyvdftpnrdyvyniqtpqafdkkliyamyeky
lasefkvtddsqlfeffdrdekvkvvhgeysnikittqediifanaylqr

Sequence, based on observed residues (ATOM records): (download)

>d4kt7a1 c.68.1.0 (A:1-230) automated matches {Anaerococcus prevotii [TaxId: 525919]}
midgkfisaiitaagsglrmpyievggrkvleitldtvsrvkeideiilvirkddediik
dilekydgniryvygsttrelstfeglkaldpqselvlthdgvrpfaseelflktinalr
knkavitatkskdtvkiidddmyvdftpnrdyvyniqtpqafdkkliyamyekylasefk
vtddsqlfeffdrdekvkvvhgeysnikittqediifanaylqr

SCOPe Domain Coordinates for d4kt7a1:

Click to download the PDB-style file with coordinates for d4kt7a1.
(The format of our PDB-style files is described here.)

Timeline for d4kt7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kt7a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4kt7b_