SCOPe 2.08: Domain d4kaca1: 4kac A:14-304

Lineage for d4kaca1 (4kac A:14-304)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein automated matches [190880] (5 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:1831] [189207] (19 PDB entries)

8. Domain d4kaca1: 4kac A:14-304 [197265]
   Other proteins in same PDB: d4kaca2, d4kacb2
   automated match to d1bn7a_
   complexed with 1q9, nh4, pe4

Details for d4kaca1

PDB Entry: 4kac, 2.22 Å

PDB Description: X-Ray Structure of the complex HaloTag2 with HALTS. Northeast Structural Genomics Consortium (NESG) Target OR150.

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d4kaca1:

Sequence; same for both SEQRES and ATOM records:

>d4kaca1 c.69.1.8 (A:14-304) automated matches {Rhodococcus sp. [TaxId: 1831]}
eigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssylwrniiphvapshrci
apdligmgksdkpdldyffddhvryldafiealgleevvlvihdwgsalgfhwakrnper
vkgiacmefirpiptwdewpefaretfqafrtadvgreliidqnafiegalpmgvvrplt
evemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgt
pgvlippaeaarlaeslpncktvdigpglfllqednpdligseiarwlpgl

Timeline for d4kaca1:

• d4kaca1 first appeared in SCOPe 2.02, called d4kaca_
  
• d4kaca1 appears in SCOPe 2.07