| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein CD4 V-set domains [48737] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries) |
| Domain d1g9nc1: 1g9n C:1-97 [19726] Other proteins in same PDB: d1g9nc2, d1g9ng_, d1g9nh1, d1g9nh2, d1g9nl1, d1g9nl2 domain 1 complexed with nag, ndg |
PDB Entry: 1g9n (more details), 2.9 Å
SCOPe Domain Sequences for d1g9nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9nc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1g9nc1: