SCOP 1.55: Domain d1g9nc1: 1g9n C:1-97

Lineage for d1g9nc1 (1g9n C:1-97)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein CD4 [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (12 PDB entries)

8. Domain d1g9nc1: 1g9n C:1-97 [19726]
   Other proteins in same PDB: d1g9nc2, d1g9ng_, d1g9nh1, d1g9nh2, d1g9nl1, d1g9nl2

Details for d1g9nc1

PDB Entry: 1g9n, 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9nc1:

Sequence; same for both SEQRES and ATOM records:

>d1g9nc1 b.1.1.1 (C:1-97) CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1g9nc1:

• d1g9nc1 appears in SCOP 1.57
  
• d1g9nc1 appears in the current release, SCOPe 2.08