Lineage for d1g9nc1 (1g9n C:1-97)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7022Protein CD4 [48737] (2 species)
  7. 7023Species Human (Homo sapiens) [TaxId:9606] [48738] (12 PDB entries)
  8. 7031Domain d1g9nc1: 1g9n C:1-97 [19726]
    Other proteins in same PDB: d1g9nc2, d1g9ng_, d1g9nh1, d1g9nh2, d1g9nl1, d1g9nl2

Details for d1g9nc1

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (C:)

SCOP Domain Sequences for d1g9nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9nc1 b.1.1.1 (C:1-97) CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1g9nc1:

Click to download the PDB-style file with coordinates for d1g9nc1.
(The format of our PDB-style files is described here.)

Timeline for d1g9nc1: