Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein automated matches [190209] (7 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:11698] [195546] (4 PDB entries) |
Domain d4id1a_: 4id1 A: [197249] automated match to d1bl3c_ complexed with lf0, so4 |
PDB Entry: 4id1 (more details), 1.87 Å
SCOPe Domain Sequences for d4id1a_:
Sequence, based on SEQRES records: (download)
>d4id1a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta vqmavfihnkkrkggiggysagerivdiiatdiq
>d4id1a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]} cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht dngsnftsttvkaacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihnk krkgggysagerivdiiatdiq
Timeline for d4id1a_: