SCOPe 2.04: Domain d4id1a_: 4id1 A:

Lineage for d4id1a_ (4id1 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (7 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11698] [195546] (4 PDB entries)

8. Domain d4id1a_: 4id1 A: [197249]
   automated match to d1bl3c_
   complexed with lf0, so4

Details for d4id1a_

PDB Entry: 4id1, 1.87 Å

PDB Description: hiv-1 integrase catalytic core domain complexed with allosteric inhibitor

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4id1a_:

Sequence, based on SEQRES records:

>d4id1a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d4id1a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihnk
krkgggysagerivdiiatdiq

Timeline for d4id1a_:

• d4id1a_ first appeared in SCOPe 2.02
  
• d4id1a_ appears in SCOPe 2.03
  
• d4id1a_ appears in SCOPe 2.05
  
• d4id1a_ appears in the current release, SCOPe 2.08