Lineage for d4id1a_ (4id1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886114Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. 2886115Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [267758] (4 PDB entries)
  8. 2886116Domain d4id1a_: 4id1 A: [197249]
    automated match to d1bl3c_
    complexed with lf0, so4

Details for d4id1a_

PDB Entry: 4id1 (more details), 1.87 Å

PDB Description: hiv-1 integrase catalytic core domain complexed with allosteric inhibitor
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4id1a_:

Sequence, based on SEQRES records: (download)

>d4id1a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d4id1a_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsttvkaacwwagikqefgiesmnkelkkiigqvrdqaehlktavqmavfihnk
krkgggysagerivdiiatdiq

SCOPe Domain Coordinates for d4id1a_:

Click to download the PDB-style file with coordinates for d4id1a_.
(The format of our PDB-style files is described here.)

Timeline for d4id1a_: