SCOPe 2.07: Domain d4gh8b_: 4gh8 B:

Lineage for d4gh8b_ (4gh8 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Escherichia coli [TaxId:562] [53600] (81 PDB entries)

8. Domain d4gh8b_: 4gh8 B: [197243]
   automated match to d3ql0a_
   complexed with ca, mtx, ndp

Details for d4gh8b_

PDB Entry: 4gh8, 1.85 Å

PDB Description: crystal structure of a 'humanized' e. coli dihydrofolate reductase

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4gh8b_:

Sequence; same for both SEQRES and ATOM records:

>d4gh8b_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwpplpadlawfkrntlnkpvimgrhtwesipeknrplpg
rkniilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthid
aevegdthfpdyepddwesvfsefhdadaqnshsycfeiler

Timeline for d4gh8b_:

• d4gh8b_ first appeared in SCOPe 2.02
  
• d4gh8b_ appears in SCOPe 2.06