Lineage for d1gc1c1 (1gc1 C:1-97)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510334Protein CD4 V-set domains [48737] (2 species)
  7. 1510335Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries)
  8. 1510354Domain d1gc1c1: 1gc1 C:1-97 [19724]
    Other proteins in same PDB: d1gc1c2, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1, d1gc1l2
    domain 1
    complexed with nag

Details for d1gc1c1

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody
PDB Compounds: (C:) cd4

SCOPe Domain Sequences for d1gc1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1c1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d1gc1c1:

Click to download the PDB-style file with coordinates for d1gc1c1.
(The format of our PDB-style files is described here.)

Timeline for d1gc1c1: