![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD4 V-set domains [48737] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries) |
![]() | Domain d1gc1c1: 1gc1 C:1-97 [19724] Other proteins in same PDB: d1gc1c2, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1, d1gc1l2 domain 1 complexed with nag |
PDB Entry: 1gc1 (more details), 2.5 Å
SCOPe Domain Sequences for d1gc1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gc1c1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1gc1c1: