SCOP 1.67: Domain d1gc1c1: 1gc1 C:1-97

Lineage for d1gc1c1 (1gc1 C:1-97)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
Protein CD4 V-set domains [48737] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [48738] (15 PDB entries)
Domain d1gc1c1: 1gc1 C:1-97 [19724]
Other proteins in same PDB: d1gc1c2, d1gc1g_, d1gc1h1, d1gc1h2, d1gc1l1, d1gc1l2
domain 1
complexed with fuc, nag; mutant

Details for d1gc1c1

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

SCOP Domain Sequences for d1gc1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1c1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1gc1c1:

Click to download the PDB-style file with coordinates for d1gc1c1.
(The format of our PDB-style files is described here.)

Timeline for d1gc1c1: