SCOPe 2.02: Domain d4fazc_: 4faz C:

Lineage for d4fazc_ (4faz C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (11 species)
   not a true protein

7. Species Methylibium petroleiphilum [TaxId:420662] [197231] (2 PDB entries)

8. Domain d4fazc_: 4faz C: [197233]
   automated match to d1otfa_
   complexed with so4

Details for d4fazc_

PDB Entry: 4faz, 1.57 Å

PDB Description: Kinetic and structural characterization of the 4-oxalocrotonate tautomerase isozymes from Methylibium petroleiphilum

PDB Compounds: (C:) 4-oxalocrotonate isomerase protein

SCOPe Domain Sequences for d4fazc_:

Sequence; same for both SEQRES and ATOM records:

>d4fazc_ d.80.1.0 (C:) automated matches {Methylibium petroleiphilum [TaxId: 420662]}
pfaqiyliegrteeqkraviekvtqammeavgapkenvrvwihdvpkenwgiggvsakal
gr

Timeline for d4fazc_:

• d4fazc_ is new in SCOPe 2.02-stable
  
• d4fazc_ appears in SCOPe 2.03
  
• d4fazc_ appears in the current release, SCOPe 2.08