![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein N-terminal domain of CD4 [48737] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries) |
![]() | Domain d1cdu_1: 1cdu 1-97 [19723] Other proteins in same PDB: d1cdu_2 |
PDB Entry: 1cdu (more details), 2.7 Å
SCOP Domain Sequences for d1cdu_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdu_1 b.1.1.1 (1-97) N-terminal domain of CD4 {Human (Homo sapiens)} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsvltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d1cdu_1: