SCOPe 2.08: Domain d1cdua1: 1cdu A:1-97

Lineage for d1cdua1 (1cdu A:1-97)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries)

8. Domain d1cdua1: 1cdu A:1-97 [19723]
   Other proteins in same PDB: d1cdua2
   domain 1
   mutant

Details for d1cdua1

PDB Entry: 1cdu, 2.7 Å

PDB Description: structure of t-cell surface glycoprotein cd4 mutant with phe 43 replaced by val

PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d1cdua1:

Sequence; same for both SEQRES and ATOM records:

>d1cdua1 b.1.1.1 (A:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsvltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d1cdua1:

• d1cdua1 first appeared (with stable ids) in SCOP 1.55, called d1cdu_1
  
• d1cdua1 appears in SCOPe 2.07