SCOPe 2.05: Domain d4aj6b_: 4aj6 B:

Lineage for d4aj6b_ (4aj6 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (7 PDB entries)

8. Domain d4aj6b_: 4aj6 B: [197217]
   automated match to d1xwaa_
   complexed with act, dtt, gol

Details for d4aj6b_

PDB Entry: 4aj6, 2 Å

PDB Description: Crystallographic structure of thioredoxin from Litopenaeus vannamei (reduced form).

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d4aj6b_:

Sequence; same for both SEQRES and ATOM records:

>d4aj6b_ c.47.1.1 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk

Timeline for d4aj6b_:

• d4aj6b_ first appeared in SCOPe 2.02
  
• d4aj6b_ appears in SCOPe 2.04
  
• d4aj6b_ appears in SCOPe 2.06
  
• d4aj6b_ appears in the current release, SCOPe 2.08