Lineage for d3zoqa_ (3zoq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855129Family c.18.1.0: automated matches [193165] (1 protein)
    not a true family
  6. 2855130Protein automated matches [193166] (6 species)
    not a true protein
  7. 2855131Species Bacillus subtilis [TaxId:224308] [193167] (2 PDB entries)
  8. 2855132Domain d3zoqa_: 3zoq A: [197213]
    automated match to d1lqja_
    complexed with cl, gol

Details for d3zoqa_

PDB Entry: 3zoq (more details), 1.45 Å

PDB Description: structure of bsudg-p56 complex
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d3zoqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zoqa_ c.18.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
qllqdswwnqlkeefekpyyqelremlkreyaeqtiypdsrdifnalhytsyddvkvvil
gqdpyhgpgqaqglsfsvkpgvkqppslkniflelqqdigcsipnhgslvswakqgvlll
ntvltvrrgqanshkgkgwerltdriidvlsererpvifilwgrhaqmkkeridtskhfi
iesthpspfsarngffgsrpfsranaylekmgeapidwcikdl

SCOPe Domain Coordinates for d3zoqa_:

Click to download the PDB-style file with coordinates for d3zoqa_.
(The format of our PDB-style files is described here.)

Timeline for d3zoqa_: