SCOP 1.65: Domain d1g9mc1: 1g9m C:1-97

Lineage for d1g9mc1 (1g9m C:1-97)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
Protein N-terminal domain of CD4 [48737] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)
Domain d1g9mc1: 1g9m C:1-97 [19721]
Other proteins in same PDB: d1g9mc2, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml1, d1g9ml2
complexed with fuc, ioh, nag; mutant

Details for d1g9mc1

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9mc1 b.1.1.1 (C:1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1g9mc1:

Click to download the PDB-style file with coordinates for d1g9mc1.
(The format of our PDB-style files is described here.)

Timeline for d1g9mc1: