SCOPe 2.05: Domain d3cd4a1: 3cd4 A:1-97

Lineage for d3cd4a1 (3cd4 A:1-97)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries)

8. Domain d3cd4a1: 3cd4 A:1-97 [19720]
   Other proteins in same PDB: d3cd4a2
   domain 1

Details for d3cd4a1

PDB Entry: 3cd4, 2.2 Å

PDB Description: refinement and analysis of the first two domains of human cd4

PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOPe Domain Sequences for d3cd4a1:

Sequence; same for both SEQRES and ATOM records:

>d3cd4a1 b.1.1.1 (A:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d3cd4a1:

• d3cd4a1 first appeared (with stable ids) in SCOP 1.55, called d3cd4_1
  
• d3cd4a1 appears in SCOPe 2.04
  
• d3cd4a1 appears in SCOPe 2.06
  
• d3cd4a1 appears in the current release, SCOPe 2.08