SCOP 1.59: Domain d3cd4_1: 3cd4 1-97

Lineage for d3cd4_1 (3cd4 1-97)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein N-terminal domain of CD4 [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)

8. Domain d3cd4_1: 3cd4 1-97 [19720]
   Other proteins in same PDB: d3cd4_2

Details for d3cd4_1

PDB Entry: 3cd4, 2.2 Å

PDB Description: refinement and analysis of the first two domains of human cd4

SCOP Domain Sequences for d3cd4_1:

Sequence; same for both SEQRES and ATOM records:

>d3cd4_1 b.1.1.1 (1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d3cd4_1:

• d3cd4_1 first appeared (with stable ids) in SCOP 1.55
  
• d3cd4_1 appears in SCOP 1.57
  
• d3cd4_1 appears in SCOP 1.61
  
• d3cd4_1 appears in the current release, SCOPe 2.08, called d3cd4a1