![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries) |
![]() | Domain d4jwya_: 4jwy A: [197199] automated match to d2a5tb_ complexed with 1n4 |
PDB Entry: 4jwy (more details), 2 Å
SCOPe Domain Sequences for d4jwya_:
Sequence, based on SEQRES records: (download)
>d4jwya_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} qhltvatleerpfvivepadpisgtcirdsvpcrsqlnrthspppdaprpekrcckgfci dilkrlahtigfsydlylvtngkhgkkidgvwngmigevfyqradmaigsltineersei vdfsvpfvetgisvmvargttvsglsdrkfqrpqeqypplkfgtvpngsteknirsnypd mhsymvrynqprveealtqlkagkldafiydaavlnymarkdegcklvtigsgkvfattg ygialhkgsrwkrpidlallqflgddeiemlerlwlsgich
>d4jwya_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} qhltvatleerpfvivepadpisgtcirdsvpcrsqlnekrcckgfcidilkrlahtigf sydlylvtngkhgkkidgvwngmigevfyqradmaigsltineerseivdfsvpfvetgi svmvargttvsglsdrkfqrpqeqypplkfgtvpngsteknirsnypdmhsymvrynqpr veealtqlkagkldafiydaavlnymarkdegcklvtigsgkvfattgygialhkgsrwk rpidlallqflgddeiemlerlwlsgich
Timeline for d4jwya_: