![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
![]() | Protein automated matches [190191] (2 species) not a true protein |
![]() | Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries) |
![]() | Domain d4jnja_: 4jnj A: [197198] automated match to d1rxkb_ complexed with btn, zn |
PDB Entry: 4jnj (more details), 1.9 Å
SCOPe Domain Sequences for d4jnja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jnja_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]} gaeagitgtwynqsgstftvtagadgnltgqyenraqgtgcqnspytltgryngtklewr vewnnstenchsrtewrgqyqggaearintqwnltyeggsgpateqgqdtftkvk
Timeline for d4jnja_: