![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (13 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197196] (4 PDB entries) |
![]() | Domain d4jqua1: 4jqu A:2-165 [197197] Other proteins in same PDB: d4jqua2 automated match to d2ucza_ complexed with btb, peg |
PDB Entry: 4jqu (more details), 1.81 Å
SCOPe Domain Sequences for d4jqua1:
Sequence, based on SEQRES records: (download)
>d4jqua1 d.20.1.1 (A:2-165) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp kdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekill svmsmlsepniesganidacilwrdnrpeferqvklsilkslgf
>d4jqua1 d.20.1.1 (A:2-165) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp kdyplsppkltftpsilhpniypngevcisilhspyelaeerwspvqsvekillsvmsml sepniesganidacilwrdnrpeferqvklsilkslgf
Timeline for d4jqua1: