Lineage for d4jqua1 (4jqu A:2-165)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164135Family d.20.1.1: UBC-related [54496] (7 protein domains)
  6. 2164342Protein automated matches [190124] (12 species)
    not a true protein
  7. 2164346Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197196] (4 PDB entries)
  8. 2164347Domain d4jqua1: 4jqu A:2-165 [197197]
    Other proteins in same PDB: d4jqua2
    automated match to d2ucza_
    complexed with btb, peg

Details for d4jqua1

PDB Entry: 4jqu (more details), 1.81 Å

PDB Description: crystal structure of ubc7p in complex with the u7br of cue1p
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 7

SCOPe Domain Sequences for d4jqua1:

Sequence, based on SEQRES records: (download)

>d4jqua1 d.20.1.1 (A:2-165) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp
kdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsvekill
svmsmlsepniesganidacilwrdnrpeferqvklsilkslgf

Sequence, based on observed residues (ATOM records): (download)

>d4jqua1 d.20.1.1 (A:2-165) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfnaklefp
kdyplsppkltftpsilhpniypngevcisilhspyelaeerwspvqsvekillsvmsml
sepniesganidacilwrdnrpeferqvklsilkslgf

SCOPe Domain Coordinates for d4jqua1:

Click to download the PDB-style file with coordinates for d4jqua1.
(The format of our PDB-style files is described here.)

Timeline for d4jqua1: