Lineage for d4ixfx_ (4ixf X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903757Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2903779Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)
  8. 2903787Domain d4ixfx_: 4ixf X: [197194]
    automated match to d3nzbx_
    complexed with ixf, ndp

Details for d4ixfx_

PDB Entry: 4ixf (more details), 1.7 Å

PDB Description: pcdhfr-269 f69n variant
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d4ixfx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixfx_ c.71.1.1 (X:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
twesiplqnrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl

SCOPe Domain Coordinates for d4ixfx_:

Click to download the PDB-style file with coordinates for d4ixfx_.
(The format of our PDB-style files is described here.)

Timeline for d4ixfx_: