Lineage for d1cdy_1 (1cdy 1-97)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52814Protein N-terminal domain of CD4 [48737] (2 species)
  7. 52815Species Human (Homo sapiens) [TaxId:9606] [48738] (13 PDB entries)
  8. 52816Domain d1cdy_1: 1cdy 1-97 [19719]
    Other proteins in same PDB: d1cdy_2

Details for d1cdy_1

PDB Entry: 1cdy (more details), 2 Å

PDB Description: structure of t-cell surface glycoprotein cd4 mutant with gly 47 replaced by ser

SCOP Domain Sequences for d1cdy_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdy_1 b.1.1.1 (1-97) N-terminal domain of CD4 {Human (Homo sapiens)}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkspsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOP Domain Coordinates for d1cdy_1:

Click to download the PDB-style file with coordinates for d1cdy_1.
(The format of our PDB-style files is described here.)

Timeline for d1cdy_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdy_2