![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
![]() | Protein automated matches [190230] (14 species) not a true protein |
![]() | Species Trichinella spiralis [TaxId:6334] [197187] (1 PDB entry) |
![]() | Domain d4i6nc_: 4i6n C: [197188] Other proteins in same PDB: d4i6nb_, d4i6nd_ automated match to d3risd_ complexed with dtt, gve, na |
PDB Entry: 4i6n (more details), 1.7 Å
SCOPe Domain Sequences for d4i6nc_:
Sequence, based on SEQRES records: (download)
>d4i6nc_ d.3.1.0 (C:) automated matches {Trichinella spiralis [TaxId: 6334]} plgsmaegnwcliesdpgiftemihgfgctglqveelvvldesiehlkpihgfiflfrwl kkemrkevddspqtctdvyfsqqviqnacasqalinlllncdhpdvdlgptlkefkdfty dldsasrglcltnsekiravhnsfgrqqlfeiddqqkldeedvfhfvtyvpvndgvyeld glraaplrlgtvasdgdwtevaikaikekiknygesevrfnlmavisd
>d4i6nc_ d.3.1.0 (C:) automated matches {Trichinella spiralis [TaxId: 6334]} plgsmaegnwcliesdpgiftemihgfgctglqveelvvldesiehlkpihgfiflfrwl kkemrkevddspqtctdvyfsqqviqnacasqalinlllncdhpdvdlgptlkefkdfty dldsasrglcltnsekiravhnsfgkldeedvfhfvtyvpvndgvyeldglraaplrlgt vasdgdwtevaikaikekiknygesevrfnlmavisd
Timeline for d4i6nc_: