Lineage for d4huaa_ (4hua A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876454Species Escherichia coli K-12 [TaxId:83333] [188760] (3 PDB entries)
  8. 2876455Domain d4huaa_: 4hua A: [197186]
    automated match to d2trxa_
    complexed with cu

Details for d4huaa_

PDB Entry: 4hua (more details), 1.1 Å

PDB Description: e. coli thioredoxin variant with (4r)-fluoropro76 as single proline residue
PDB Compounds: (A:) Thioredoxin-1

SCOPe Domain Sequences for d4huaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4huaa_ c.47.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
sdkiihltddsfdtdvlkadgailvdfwaewcgackmiaaildeiadeyqgkltvaklni
dqnagtaakygirgixtlllfkngevaatkvgalskgqlkefldanla

SCOPe Domain Coordinates for d4huaa_:

Click to download the PDB-style file with coordinates for d4huaa_.
(The format of our PDB-style files is described here.)

Timeline for d4huaa_: