Lineage for d4haad_ (4haa D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2531160Protein automated matches [190834] (3 species)
    not a true protein
  7. 2531164Species Bacillus intermedius [TaxId:1400] [194484] (1 PDB entry)
  8. 2531168Domain d4haad_: 4haa D: [197182]
    automated match to d4haab_
    mutant

Details for d4haad_

PDB Entry: 4haa (more details), 1.9 Å

PDB Description: Structure of Ribonuclease Binase Glu43Ala/Phe81Ala Mutant
PDB Compounds: (D:) Ribonuclease

SCOPe Domain Sequences for d4haad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4haad_ d.1.1.2 (D:) automated matches {Bacillus intermedius [TaxId: 1400]}
avintfdgvadylirykrlpdnyitksqasalgwvaskgnlaavapgksiggdvfsnreg
rlpsasgrtwreadinyvsgarnadrlvyssdwliykttdhyatftrir

SCOPe Domain Coordinates for d4haad_:

Click to download the PDB-style file with coordinates for d4haad_.
(The format of our PDB-style files is described here.)

Timeline for d4haad_: