Lineage for d4gj3a1 (4gj3 A:890-1176)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2591262Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2591263Protein automated matches [190417] (35 species)
    not a true protein
  7. 2591422Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)
  8. 2592180Domain d4gj3a1: 4gj3 A:890-1176 [197178]
    Other proteins in same PDB: d4gj3a2
    automated match to d3nz0a_
    complexed with 0xp

Details for d4gj3a1

PDB Entry: 4gj3 (more details), 2.5 Å

PDB Description: Tyk2 (JH1) in complex with 2,6-dichloro-4-cyano-N-[2-({[(1R,2R)-2-fluorocyclopropyl]carbonyl}amino)pyridin-4-yl]benzamide
PDB Compounds: (A:) Non-receptor tyrosine-protein kinase TYK2

SCOPe Domain Sequences for d4gj3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gj3a1 d.144.1.0 (A:890-1176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfhkrylkkirdlgeghfgkvslycydptndgtgemvavkalkadagpqhrsgwkqeid
ilrtlyhehiikykgccedagaaslqlvmeyvplgslrdylprhsiglaqlllfaqqice
gmaylhaqhyihrnlaarnvlldndrlvkigdfglakavpegheyyrvredgdspvfwya
peclkeykfyyasdvwsfgvtlyellthcdssqspptkfleligiaqgqmtvlrltelle
rgerlprpdkcpaevyhlmkncweteasfrptfenlipilktvheky

SCOPe Domain Coordinates for d4gj3a1:

Click to download the PDB-style file with coordinates for d4gj3a1.
(The format of our PDB-style files is described here.)

Timeline for d4gj3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gj3a2