SCOPe 2.02: Domain d4gj3a_: 4gj3 A:

Lineage for d4gj3a_ (4gj3 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (54 PDB entries)

8. Domain d4gj3a_: 4gj3 A: [197178]
   automated match to d3nz0a_
   complexed with 0xp

Details for d4gj3a_

PDB Entry: 4gj3, 2.5 Å

PDB Description: Tyk2 (JH1) in complex with 2,6-dichloro-4-cyano-N-[2-({[(1R,2R)-2-fluorocyclopropyl]carbonyl}amino)pyridin-4-yl]benzamide

PDB Compounds: (A:) Non-receptor tyrosine-protein kinase TYK2

SCOPe Domain Sequences for d4gj3a_:

Sequence; same for both SEQRES and ATOM records:

>d4gj3a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfhkrylkkirdlgeghfgkvslycydptndgtgemvavkalkadagpqhrsgwkqeid
ilrtlyhehiikykgccedagaaslqlvmeyvplgslrdylprhsiglaqlllfaqqice
gmaylhaqhyihrnlaarnvlldndrlvkigdfglakavpegheyyrvredgdspvfwya
peclkeykfyyasdvwsfgvtlyellthcdssqspptkfleligiaqgqmtvlrltelle
rgerlprpdkcpaevyhlmkncweteasfrptfenlipilktvhekyr

Timeline for d4gj3a_:

• d4gj3a_ is new in SCOPe 2.02-stable
  
• d4gj3a_ appears in SCOPe 2.03
  
• d4gj3a_ appears in the current release, SCOPe 2.08, called d4gj3a1