Lineage for d4g8zx_ (4g8z X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903944Protein automated matches [190514] (12 species)
    not a true protein
  7. 2903985Species Pneumocystis jirovecii [TaxId:42068] [197174] (1 PDB entry)
  8. 2903986Domain d4g8zx_: 4g8z X: [197175]
    automated match to d1dyra_
    complexed with ndp, top; mutant

Details for d4g8zx_

PDB Entry: 4g8z (more details), 1.75 Å

PDB Description: pcDHFR K37S/F69N double mutant TMP NADPH ternary complex
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d4g8zx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g8zx_ c.71.1.1 (X:) automated matches {Pneumocystis jirovecii [TaxId: 42068]}
qqksltlivalttsygigrsnslpwklkkeisyfsrvtsfvptfdsfesmnvvlmgrktw
esiplqnrplkgrinvvitrnaaaaaaaaihsaksldhalellyrtygsessvqinrifv
iggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswvg
tkvphgkinedgfdyefemwtrdl

SCOPe Domain Coordinates for d4g8zx_:

Click to download the PDB-style file with coordinates for d4g8zx_.
(The format of our PDB-style files is described here.)

Timeline for d4g8zx_: