![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein automated matches [190514] (12 species) not a true protein |
![]() | Species Pneumocystis jirovecii [TaxId:42068] [197174] (1 PDB entry) |
![]() | Domain d4g8zx_: 4g8z X: [197175] automated match to d1dyra_ complexed with ndp, top; mutant |
PDB Entry: 4g8z (more details), 1.75 Å
SCOPe Domain Sequences for d4g8zx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g8zx_ c.71.1.1 (X:) automated matches {Pneumocystis jirovecii [TaxId: 42068]} qqksltlivalttsygigrsnslpwklkkeisyfsrvtsfvptfdsfesmnvvlmgrktw esiplqnrplkgrinvvitrnaaaaaaaaihsaksldhalellyrtygsessvqinrifv iggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswvg tkvphgkinedgfdyefemwtrdl
Timeline for d4g8zx_: