SCOPe 2.05: Domain d4g9lb_: 4g9l B:

Lineage for d4g9lb_ (4g9l B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)

8. Domain d4g9lb_: 4g9l B: [197172]
   automated match to d1hy7b_
   complexed with ca, ngh, zn

Details for d4g9lb_

PDB Entry: 4g9l, 1.88 Å

PDB Description: Structure of MMP3 complexed with NNGH inhibitor.

PDB Compounds: (B:) stromelysin-1

SCOPe Domain Sequences for d4g9lb_:

Sequence; same for both SEQRES and ATOM records:

>d4g9lb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
ipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfav
rehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighslg
lfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

Timeline for d4g9lb_:

• d4g9lb_ first appeared in SCOPe 2.02
  
• d4g9lb_ appears in SCOPe 2.04
  
• d4g9lb_ appears in SCOPe 2.06
  
• d4g9lb_ appears in the current release, SCOPe 2.08