Lineage for d1bqhi_ (1bqh I:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51669Protein CD8 [48734] (2 species)
  7. 51674Species Mouse (Mus musculus) [TaxId:10090] [48736] (1 PDB entry)
  8. 51677Domain d1bqhi_: 1bqh I: [19717]
    Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhb1, d1bqhd1, d1bqhd2, d1bqhe1

Details for d1bqhi_

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

SCOP Domain Sequences for d1bqhi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqhi_ b.1.1.1 (I:) CD8 {Mouse (Mus musculus)}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs
sa

SCOP Domain Coordinates for d1bqhi_:

Click to download the PDB-style file with coordinates for d1bqhi_.
(The format of our PDB-style files is described here.)

Timeline for d1bqhi_: