Lineage for d1bqhh_ (1bqh H:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) 
Protein CD8 [48734] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [48736] (1 PDB entry) 
Domain d1bqhh_: 1bqh H: [19716]
Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhb1, d1bqhd1, d1bqhd2, d1bqhe1
Details for d1bqhh_
PDB Entry: 1bqh (more details), 2.8 Å
PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8
SCOP Domain Sequences for d1bqhh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqhh_ b.1.1.1 (H:) CD8 {Mouse (Mus musculus)}
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
kvssa
SCOP Domain Coordinates for d1bqhh_:
Click to download the PDB-style file with coordinates for d1bqhh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bqhh_:
- d1bqhh_ appears in SCOP 1.57
- d1bqhh_ appears in the current release, SCOPe 2.08
View in 3D
