| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein CD8 [48734] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries) |
| Domain d1bqhh_: 1bqh H: [19716] Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhb_, d1bqhd1, d1bqhd2, d1bqhe_, d1bqhi2 complexed with nag |
PDB Entry: 1bqh (more details), 2.8 Å
SCOPe Domain Sequences for d1bqhh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqhh_ b.1.1.1 (H:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
kvssa
Timeline for d1bqhh_: