Lineage for d1bqhg_ (1bqh G:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7047Protein CD8 [48734] (2 species)
  7. 7052Species Mouse (Mus musculus) [TaxId:10090] [48736] (1 PDB entry)
  8. 7053Domain d1bqhg_: 1bqh G: [19715]
    Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhb1, d1bqhd1, d1bqhd2, d1bqhe1

Details for d1bqhg_

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

SCOP Domain Sequences for d1bqhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqhg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus)}
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
kv

SCOP Domain Coordinates for d1bqhg_:

Click to download the PDB-style file with coordinates for d1bqhg_.
(The format of our PDB-style files is described here.)

Timeline for d1bqhg_: