Lineage for d4bfbb_ (4bfb B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2393810Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2393811Protein automated matches [190954] (11 species)
    not a true protein
  7. 2393838Species Human (Homo sapiens) [TaxId:9606] [193159] (12 PDB entries)
  8. 2393850Domain d4bfbb_: 4bfb B: [197147]
    Other proteins in same PDB: d4bfbd1, d4bfbd2, d4bfbe1, d4bfbe2
    automated match to d2qzka_
    complexed with b3p

Details for d4bfbb_

PDB Entry: 4bfb (more details), 2.21 Å

PDB Description: bace2 xaperone complex
PDB Compounds: (B:) Beta-secretase 2

SCOPe Domain Sequences for d4bfbb_:

Sequence, based on SEQRES records: (download)

>d4bfbb_ b.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdterss
tyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngi
lglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggiep
slykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvf
davveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritil
pqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaei
agaavseisgpfstedvasncvp

Sequence, based on observed residues (ATOM records): (download)

>d4bfbb_ b.50.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdterss
tyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngi
lglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvaggslvlggiepslykg
diwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavve
avaraslidgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpmm
gaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseis
gpfstedvasncvp

SCOPe Domain Coordinates for d4bfbb_:

Click to download the PDB-style file with coordinates for d4bfbb_.
(The format of our PDB-style files is described here.)

Timeline for d4bfbb_: