Lineage for d4bela_ (4bel A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2393810Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2393811Protein automated matches [190954] (11 species)
    not a true protein
  7. 2393838Species Human (Homo sapiens) [TaxId:9606] [193159] (12 PDB entries)
  8. 2393840Domain d4bela_: 4bel A: [197144]
    Other proteins in same PDB: d4beld1, d4beld2, d4bele1, d4bele2
    automated match to d2qzka_
    complexed with b3p, cl

Details for d4bela_

PDB Entry: 4bel (more details), 1.85 Å

PDB Description: bace2 xaperone complex
PDB Compounds: (A:) Beta-secretase 2

SCOPe Domain Sequences for d4bela_:

Sequence, based on SEQRES records: (download)

>d4bela_ b.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdters
styrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwng
ilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggie
pslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkv
fdavveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfriti
lpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcae
iagaavseisgpfstedvasncvp

Sequence, based on observed residues (ATOM records): (download)

>d4bela_ b.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdters
styrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwng
ilglayatlakpsssletffdslvtqanipnvfsmqmcgagggslvlggiepslykgdiw
ytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveava
rassdgfwtgsqlacwtpwsyfpkisiylrdenssrsfritilpqlyiqpmcyrfgisps
tnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisgpfstedvasncvp

SCOPe Domain Coordinates for d4bela_:

Click to download the PDB-style file with coordinates for d4bela_.
(The format of our PDB-style files is described here.)

Timeline for d4bela_: