| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) ![]() |
| Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
| Protein automated matches [190229] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187292] (42 PDB entries) |
| Domain d4b7pa_: 4b7p A: [197140] automated match to d3ekob_ complexed with 9un |
PDB Entry: 4b7p (more details), 1.7 Å
SCOPe Domain Sequences for d4b7pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b7pa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskld
sgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismi
gqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlk
edqteyleerrikeivkkhsqfigypitlfveke
Timeline for d4b7pa_: