SCOPe 2.02: Domain d4b7pa_: 4b7p A:

Lineage for d4b7pa_ (4b7p A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (42 PDB entries)

8. Domain d4b7pa_: 4b7p A: [197140]
   automated match to d3ekob_
   complexed with 9un

Details for d4b7pa_

PDB Entry: 4b7p, 1.7 Å

PDB Description: Structure of HSP90 with NMS-E973 inhibitor bound

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d4b7pa_:

Sequence; same for both SEQRES and ATOM records:

>d4b7pa_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskld
sgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismi
gqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlk
edqteyleerrikeivkkhsqfigypitlfveke

Timeline for d4b7pa_:

• d4b7pa_ is new in SCOPe 2.02-stable
  
• d4b7pa_ appears in SCOPe 2.03
  
• d4b7pa_ appears in the current release, SCOPe 2.08