![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein CD8 [48734] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48735] (3 PDB entries) |
![]() | Domain d1cd8a_: 1cd8 A: [19714] complexed with so4 |
PDB Entry: 1cd8 (more details), 2.6 Å
SCOPe Domain Sequences for d1cd8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd8a_ b.1.1.1 (A:) CD8 {Human (Homo sapiens) [TaxId: 9606]} sqfrvspldrtwnlgetvelkcqvllsnptsgcswlfqprgaaasptfllylsqnkpkaa egldtqrfsgkrlgdtfvltlsdfrrenegyyfcsalsnsimyfshfvpvflpa
Timeline for d1cd8a_: